PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00057g00623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family BES1
Protein Properties Length: 324aa    MW: 34670.7 Da    PI: 8.8926
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00057g00623.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822218.21.9e-67271552130
                    DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssa 86 
                               +++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+++++ +e++g+sa
  Peaxi162Scf00057g00623.1  27 SGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCSRPTPMEIGGTSA 111
                               799********************************************************************************** PP

                    DUF822  87 saspesslqsslkssalaspvesysaspksssfpspssldsisl 130
                               +++p+ss + s+ ss++asp++sy++sp+sssfpsps++d +++
  Peaxi162Scf00057g00623.1 112 NITPSSSRNPSPPSSYFASPIPSYQPSPTSSSFPSPSRVDANMS 155
                               ****************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.1E-6227156IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MMWEGGGEDG GGGGGVGGGG AGGGSSSGRR KPSWRERENN RRRERRRRAI AAKIYAGLRA  60
QGNYNLPKHC DNNEVLKALC AEAGWIVEPD GTTYRKGCSR PTPMEIGGTS ANITPSSSRN  120
PSPPSSYFAS PIPSYQPSPT SSSFPSPSRV DANMSPFAFL HNTIPSSLPP LRISNSAPVT  180
PPLSSPTRLP KQTFNLETLA RESMSAFNIP FFAASAPTSP TRGQRFTPAT IPECDESDTS  240
TIDSGQWMSF QKYAANGVPT SPTFNLIKPA AQRIPSNDMI IDKGKSIEFD FENVSVKAAW  300
EGEKIHEVGL DDLELTLGGG SSRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12847RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2474440.0KP247444.1 Nicotiana benthamiana BES1/BZR1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781919.11e-179PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
RefseqXP_016470141.11e-179PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-113BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0F6VYB21e-173A0A0F6VYB2_NICBE; BES1/BZR1
STRINGSolyc04g079980.2.11e-171(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.27e-93BES1 family protein